Lineage for d5sici_ (5sic I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916488Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 1916489Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 1916490Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)
    automatically mapped to Pfam PF00720
  6. 1916491Protein Subtilisin inhibitor [55401] (2 species)
  7. 1916495Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries)
  8. 1916497Domain d5sici_: 5sic I: [40029]
    Other proteins in same PDB: d5sice_
    complexed with ca

Details for d5sici_

PDB Entry: 5sic (more details), 2.2 Å

PDB Description: molecular recognition at the active site of subtilisin bpn': crystallographic studies using genetically engineered proteinaceous inhibitor ssi (streptomyces subtilisin inhibitor)
PDB Compounds: (I:) subtilisin inhibitor (ssi)

SCOPe Domain Sequences for d5sici_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans [TaxId: 1916]}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvgcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

SCOPe Domain Coordinates for d5sici_:

Click to download the PDB-style file with coordinates for d5sici_.
(The format of our PDB-style files is described here.)

Timeline for d5sici_: