Lineage for d3sici_ (3sic I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203914Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 2203915Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 2203916Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)
    automatically mapped to Pfam PF00720
  6. 2203917Protein Subtilisin inhibitor [55401] (2 species)
  7. 2203921Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries)
  8. 2203922Domain d3sici_: 3sic I: [40028]
    Other proteins in same PDB: d3sice_
    complexed with ca

Details for d3sici_

PDB Entry: 3sic (more details), 1.8 Å

PDB Description: molecular recognition at the active site of subtilisin bpn': crystallographic studies using genetically engineered proteinaceous inhibitor ssi (streptomyces subtilisin inhibitor)
PDB Compounds: (I:) streptomyces subtilisin inhibitor (ssi)

SCOPe Domain Sequences for d3sici_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans [TaxId: 1916]}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvmcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

SCOPe Domain Coordinates for d3sici_:

Click to download the PDB-style file with coordinates for d3sici_.
(The format of our PDB-style files is described here.)

Timeline for d3sici_: