| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies) core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander |
Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families) ![]() duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpin |
| Family d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein) |
| Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries) |
| Domain d1bp1a2: 1bp1 A:218-456 [40027] CASP2 complexed with pc1 |
PDB Entry: 1bp1 (more details), 2.4 Å
SCOPe Domain Sequences for d1bp1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bp1a2 d.83.1.1 (A:218-456) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]}
etldvqmkgefysenhhnpppfappvmefpaahdrmvylglsdyffntaglvyqeagvlk
mtlrddmipkeskfrlttkffgtflpevakkfpnmkiqihvsastpphlsvqptgltfyp
avdvqafavlpnsalaslfligmhttgsmevsaesnrlvgelkldrlllelkhsnigpfp
vellqdimnyivpilvlprvneklqkgfplptparvqlynvvlqphqnfllfgadvvyk
Timeline for d1bp1a2: