Lineage for d1bp1a1 (1bp1 A:1-217)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569020Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
    core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
  4. 2569021Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families) (S)
    duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpin
  5. 2569022Family d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein)
  6. 2569023Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species)
  7. 2569024Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries)
  8. 2569027Domain d1bp1a1: 1bp1 A:1-217 [40026]
    CASP2
    complexed with pc1

Details for d1bp1a1

PDB Entry: 1bp1 (more details), 2.4 Å

PDB Description: crystal structure of bpi, the human bactericidal permeability- increasing protein
PDB Compounds: (A:) bactericidal/permeability-increasing protein

SCOPe Domain Sequences for d1bp1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bp1a1 d.83.1.1 (A:1-217) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]}
vnpgvvvrisqkgldyasqqgtaalqkelkrikipdysdsfkikhlgkghysfysmdire
fqlpssqismvpnvglkfsisnanikisgkwkaqkrflkmsgnfdlsiegmsisadlklg
snptsgkptitcsscsshinsvhvhiskskvgwliqlfhkkiesalrnkmnsqvcekvtn
svssklqpyfqtlpvmtkidsvaginyglvappatta

SCOPe Domain Coordinates for d1bp1a1:

Click to download the PDB-style file with coordinates for d1bp1a1.
(The format of our PDB-style files is described here.)

Timeline for d1bp1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bp1a2