Lineage for d1bp1_1 (1bp1 1-217)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.83: Bactericidal permeability-increasing protein, BPI [55393] (1 superfamily) Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (1 family) 
Family d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein) Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries) 
Domain d1bp1_1: 1bp1 1-217 [40026]
Details for d1bp1_1
PDB Entry: 1bp1 (more details), 2.4 Å
PDB Description: crystal structure of bpi, the human bactericidal permeability- increasing protein
SCOP Domain Sequences for d1bp1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bp1_1 d.83.1.1 (1-217) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens)}
vnpgvvvrisqkgldyasqqgtaalqkelkrikipdysdsfkikhlgkghysfysmdire
fqlpssqismvpnvglkfsisnanikisgkwkaqkrflkmsgnfdlsiegmsisadlklg
snptsgkptitcsscsshinsvhvhiskskvgwliqlfhkkiesalrnkmnsqvcekvtn
svssklqpyfqtlpvmtkidsvaginyglvappatta
SCOP Domain Coordinates for d1bp1_1:
Click to download the PDB-style file with coordinates for d1bp1_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bp1_1:
- d1bp1_1 appears in SCOP 1.57
- d1bp1_1 appears in the current release, SCOPe 2.08, called d1bp1a1
View in 3D
