Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies) core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander |
Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families) duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpin |
Family d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein) |
Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries) |
Domain d1ewfa2: 1ewf A:218-456 [40025] complexed with pc1 |
PDB Entry: 1ewf (more details), 1.7 Å
SCOPe Domain Sequences for d1ewfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewfa2 d.83.1.1 (A:218-456) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]} etldvqmkgefysenhhnpppfappvmefpaahdrmvylglsdyffntaglvyqeagvlk mtlrddmipkeskfrlttkffgtflpevakkfpnmkiqihvsastpphlsvqptgltfyp avdvqafavlpnsalaslfligmhttgsmevsaesnrlvgelkldrlllelkhsnigpfp vellqdimnyivpilvlprvneklqkgfplptparvqlynvvlqphqnfllfgadvvyk
Timeline for d1ewfa2: