SCOPe 2.07: Domain d1ewfa2: 1ewf A:218-456

Lineage for d1ewfa2 (1ewf A:218-456)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
   core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander

4. Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families)
   duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpin

5. Family d.83.1.1: Bactericidal permeability-increasing protein, BPI [55395] (1 protein)

6. Protein Bactericidal permeability-increasing protein, BPI [55396] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55397] (2 PDB entries)

8. Domain d1ewfa2: 1ewf A:218-456 [40025]
   complexed with pc1

Details for d1ewfa2

PDB Entry: 1ewf, 1.7 Å

PDB Description: the 1.7 angstrom crystal structure of bpi

PDB Compounds: (A:) bactericidal/permeability-increasing protein

SCOPe Domain Sequences for d1ewfa2:

Sequence; same for both SEQRES and ATOM records:

>d1ewfa2 d.83.1.1 (A:218-456) Bactericidal permeability-increasing protein, BPI {Human (Homo sapiens) [TaxId: 9606]}
etldvqmkgefysenhhnpppfappvmefpaahdrmvylglsdyffntaglvyqeagvlk
mtlrddmipkeskfrlttkffgtflpevakkfpnmkiqihvsastpphlsvqptgltfyp
avdvqafavlpnsalaslfligmhttgsmevsaesnrlvgelkldrlllelkhsnigpfp
vellqdimnyivpilvlprvneklqkgfplptparvqlynvvlqphqnfllfgadvvyk

Timeline for d1ewfa2:

• d1ewfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ewfa2 appears in SCOPe 2.06
  
• d1ewfa2 appears in the current release, SCOPe 2.08