![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein automated matches [190103] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries) |
![]() | Domain d6s2kb2: 6s2k B:233-523 [400212] Other proteins in same PDB: d6s2ka1, d6s2ka3, d6s2kb1, d6s2kb3 automated match to d3u84b2 complexed with ktq |
PDB Entry: 6s2k (more details), 3.1 Å
SCOPe Domain Sequences for d6s2kb2:
Sequence, based on SEQRES records: (download)
>d6s2kb2 a.118.8.1 (B:233-523) automated matches {Human (Homo sapiens) [TaxId: 9606]} drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd ynycredeeiykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecf ahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpe ggstaqvpapaaspppegpvltfqsekmkgmkellvatkinssaiklqlta
>d6s2kb2 a.118.8.1 (B:233-523) automated matches {Human (Homo sapiens) [TaxId: 9606]} drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd ynycredeeiykeffevandvipnllkeaaslleasalqdpecfahllrfydgickweeg sptpvlhvgwatflvqslgrfegqvrqkvrivsggpvltfqsekmkgmkellvatkinss aiklqlta
Timeline for d6s2kb2: