Lineage for d6s2kb1 (6s2k B:5-232)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617877Fold d.389: Menin N-terminal domain-like [310556] (1 superfamily)
    Some structural similarity to cysteine proteinases (d.3.1.4) noted in PubMed 22327296
  4. 2617878Superfamily d.389.1: Menin N-terminal domain-like [310582] (1 family) (S)
    Pfam PF05053
  5. 2617879Family d.389.1.1: Menin N-terminal domain-like [310623] (2 proteins)
  6. 2617920Protein automated matches [400189] (1 species)
    not a true protein
  7. 2617921Species Homo sapiens [TaxId:9606] [400190] (1 PDB entry)
  8. 2617923Domain d6s2kb1: 6s2k B:5-232 [400211]
    Other proteins in same PDB: d6s2ka2, d6s2kb2
    automated match to d3u84b1
    complexed with ktq

Details for d6s2kb1

PDB Entry: 6s2k (more details), 3.1 Å

PDB Description: human menin in complex with aj21
PDB Compounds: (B:) Multiple endocrine neoplasia I, isoform CRA_b

SCOPe Domain Sequences for d6s2kb1:

Sequence, based on SEQRES records: (download)

>d6s2kb1 d.389.1.1 (B:5-232) automated matches {Homo sapiens [TaxId: 9606]}
lkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpelt
fqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvs
dviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedha
wvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrc

Sequence, based on observed residues (ATOM records): (download)

>d6s2kb1 d.389.1.1 (B:5-232) automated matches {Homo sapiens [TaxId: 9606]}
lkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvpapdppggl
tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
vtwhgkgnedrrgqtvnagvaerswlylkgsymrc

SCOPe Domain Coordinates for d6s2kb1:

Click to download the PDB-style file with coordinates for d6s2kb1.
(The format of our PDB-style files is described here.)

Timeline for d6s2kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6s2kb2