Lineage for d6s2ka2 (6s2k A:233-523)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726794Protein automated matches [190103] (5 species)
    not a true protein
  7. 2726805Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries)
  8. 2726827Domain d6s2ka2: 6s2k A:233-523 [400192]
    Other proteins in same PDB: d6s2ka1, d6s2ka3, d6s2kb1, d6s2kb3
    automated match to d3u84b2
    complexed with ktq

Details for d6s2ka2

PDB Entry: 6s2k (more details), 3.1 Å

PDB Description: human menin in complex with aj21
PDB Compounds: (A:) Multiple endocrine neoplasia I, isoform CRA_b

SCOPe Domain Sequences for d6s2ka2:

Sequence, based on SEQRES records: (download)

>d6s2ka2 a.118.8.1 (A:233-523) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecf
ahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpe
ggstaqvpapaaspppegpvltfqsekmkgmkellvatkinssaiklqlta

Sequence, based on observed residues (ATOM records): (download)

>d6s2ka2 a.118.8.1 (A:233-523) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleasalqdpecfahllrfydgickweeg
sptpvlhvgwatflvqslgrfegqvrqkvrivsgtvgpvltfqsekmkgmkellvatkin
ssaiklqlta

SCOPe Domain Coordinates for d6s2ka2:

Click to download the PDB-style file with coordinates for d6s2ka2.
(The format of our PDB-style files is described here.)

Timeline for d6s2ka2: