Lineage for d1qala4 (1qal A:7-90)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916351Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1916352Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
    automatically mapped to Pfam PF07833
  5. 1916353Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 1916354Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 1916355Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 1916380Domain d1qala4: 1qal A:7-90 [40019]
    Other proteins in same PDB: d1qala1, d1qala2, d1qala3, d1qalb1, d1qalb2, d1qalb3
    complexed with ca, cu; mutant

Details for d1qala4

PDB Entry: 1qal (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1qala4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qala4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1qala4:

Click to download the PDB-style file with coordinates for d1qala4.
(The format of our PDB-style files is described here.)

Timeline for d1qala4: