Lineage for d1d6ya4 (1d6y A:7-90)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507309Fold d.82: N domain of copper amine oxidase-like [55382] (3 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 507310Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 507311Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 507312Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 507313Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)
  8. 507330Domain d1d6ya4: 1d6y A:7-90 [40017]
    Other proteins in same PDB: d1d6ya1, d1d6ya2, d1d6ya3, d1d6yb1, d1d6yb2, d1d6yb3

Details for d1d6ya4

PDB Entry: 1d6y (more details), 2.4 Å

PDB Description: crystal structure of e. coli copper-containing amine oxidase anaerobically reduced with beta-phenylethylamine and complexed with nitric oxide.

SCOP Domain Sequences for d1d6ya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ya4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1d6ya4:

Click to download the PDB-style file with coordinates for d1d6ya4.
(The format of our PDB-style files is described here.)

Timeline for d1d6ya4: