Lineage for d1d6ya4 (1d6y A:7-90)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81800Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 81801Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 81802Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 81803Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 81804Species Escherichia coli [TaxId:562] [55386] (9 PDB entries)
  8. 81819Domain d1d6ya4: 1d6y A:7-90 [40017]
    Other proteins in same PDB: d1d6ya1, d1d6ya2, d1d6ya3, d1d6yb1, d1d6yb2, d1d6yb3

Details for d1d6ya4

PDB Entry: 1d6y (more details), 2.4 Å

PDB Description: crystal structure of e. coli copper-containing amine oxidase anaerobically reduced with beta-phenylethylamine and complexed with nitric oxide.

SCOP Domain Sequences for d1d6ya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ya4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1d6ya4:

Click to download the PDB-style file with coordinates for d1d6ya4.
(The format of our PDB-style files is described here.)

Timeline for d1d6ya4: