Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) |
Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
Species Escherichia coli [TaxId:562] [55386] (11 PDB entries) |
Domain d1d6ub4: 1d6u B:6-90 [40016] Other proteins in same PDB: d1d6ua1, d1d6ua2, d1d6ua3, d1d6ub1, d1d6ub2, d1d6ub3 |
PDB Entry: 1d6u (more details), 2.4 Å
SCOP Domain Sequences for d1d6ub4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ub4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]} hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd nkawvsdtfindvfqsgldqtfqve
Timeline for d1d6ub4:
View in 3D Domains from other chains: (mouse over for more information) d1d6ua1, d1d6ua2, d1d6ua3, d1d6ua4 |