SCOP 1.73: Domain d1d6ub4: 1d6u B:6-90

Lineage for d1d6ub4 (1d6u B:6-90)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family)

5. Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)

6. Protein Copper amine oxidase, domain N [55385] (1 species)
   non-conserved N-terminal domain

7. Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)

8. Domain d1d6ub4: 1d6u B:6-90 [40016]
   Other proteins in same PDB: d1d6ua1, d1d6ua2, d1d6ua3, d1d6ub1, d1d6ub2, d1d6ub3

Details for d1d6ub4

PDB Entry: 1d6u, 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine

PDB Compounds: (B:) copper amine oxidase

SCOP Domain Sequences for d1d6ub4:

Sequence; same for both SEQRES and ATOM records:

>d1d6ub4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

Timeline for d1d6ub4:

• d1d6ub4 first appeared (with stable ids) in SCOP 1.55
  
• d1d6ub4 appears in SCOP 1.71
  
• d1d6ub4 appears in SCOP 1.75
  
• d1d6ub4 appears in the current release, SCOPe 2.08