Lineage for d1d6ub4 (1d6u B:6-90)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527781Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) (S)
    automatically mapped to Pfam PF07833
  5. 2527782Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 2527783Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 2527784Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 2527804Domain d1d6ub4: 1d6u B:6-90 [40016]
    Other proteins in same PDB: d1d6ua1, d1d6ua2, d1d6ua3, d1d6ub1, d1d6ub2, d1d6ub3
    complexed with ca, cu, gol, hy1, pea

Details for d1d6ub4

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1d6ub4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ub4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1d6ub4:

Click to download the PDB-style file with coordinates for d1d6ub4.
(The format of our PDB-style files is described here.)

Timeline for d1d6ub4: