| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) ![]() automatically mapped to Pfam PF07833 |
| Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
| Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
| Species Escherichia coli [TaxId:562] [55386] (16 PDB entries) |
| Domain d1d6ua4: 1d6u A:7-90 [40015] Other proteins in same PDB: d1d6ua1, d1d6ua2, d1d6ua3, d1d6ub1, d1d6ub2, d1d6ub3 complexed with ca, cu, gol, hy1, pea |
PDB Entry: 1d6u (more details), 2.4 Å
SCOPe Domain Sequences for d1d6ua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6ua4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve
Timeline for d1d6ua4:
View in 3DDomains from other chains: (mouse over for more information) d1d6ub1, d1d6ub2, d1d6ub3, d1d6ub4 |