Lineage for d1qafb4 (1qaf B:6-90)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866944Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 866945Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 866946Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 866947Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 866948Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)
  8. 866966Domain d1qafb4: 1qaf B:6-90 [40014]
    Other proteins in same PDB: d1qafa1, d1qafa2, d1qafa3, d1qafb1, d1qafb2, d1qafb3
    complexed with ca, cu, gol; mutant

Details for d1qafb4

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (B:) protein (copper amine oxidase)

SCOP Domain Sequences for d1qafb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafb4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1qafb4:

Click to download the PDB-style file with coordinates for d1qafb4.
(The format of our PDB-style files is described here.)

Timeline for d1qafb4: