Lineage for d1qafa4 (1qaf A:7-90)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81800Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 81801Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 81802Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 81803Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 81804Species Escherichia coli [TaxId:562] [55386] (9 PDB entries)
  8. 81813Domain d1qafa4: 1qaf A:7-90 [40013]
    Other proteins in same PDB: d1qafa1, d1qafa2, d1qafa3, d1qafb1, d1qafb2, d1qafb3

Details for d1qafa4

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants

SCOP Domain Sequences for d1qafa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafa4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1qafa4:

Click to download the PDB-style file with coordinates for d1qafa4.
(The format of our PDB-style files is described here.)

Timeline for d1qafa4: