Lineage for d4pj0k_ (4pj0 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026682Protein automated matches [339417] (5 species)
    not a true protein
  7. 3026689Species Thermosynechococcus elongatus [TaxId:197221] [400106] (4 PDB entries)
  8. 3026690Domain d4pj0k_: 4pj0 K: [400107]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d5h2fk_
    complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0k_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d4pj0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0k_ f.23.36.1 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d4pj0k_:

Click to download the PDB-style file with coordinates for d4pj0k_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0k_: