| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
| Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
| Protein automated matches [339417] (5 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [400106] (4 PDB entries) |
| Domain d4pj0k_: 4pj0 K: [400107] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d5h2fk_ complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0k_ f.23.36.1 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d4pj0k_: