Lineage for d1dyub4 (1dyu B:6-90)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135259Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 135260Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 135261Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 135262Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 135263Species Escherichia coli [TaxId:562] [55386] (10 PDB entries)
  8. 135271Domain d1dyub4: 1dyu B:6-90 [40010]
    Other proteins in same PDB: d1dyua1, d1dyua2, d1dyua3, d1dyub1, d1dyub2, d1dyub3

Details for d1dyub4

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.

SCOP Domain Sequences for d1dyub4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyub4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1dyub4:

Click to download the PDB-style file with coordinates for d1dyub4.
(The format of our PDB-style files is described here.)

Timeline for d1dyub4: