Lineage for d1oacb4 (1oac B:5-90)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659640Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1659641Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
    automatically mapped to Pfam PF07833
  5. 1659642Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 1659643Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 1659644Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 1659646Domain d1oacb4: 1oac B:5-90 [40004]
    Other proteins in same PDB: d1oaca1, d1oaca2, d1oaca3, d1oacb1, d1oacb2, d1oacb3
    complexed with ca, cu

Details for d1oacb4

PDB Entry: 1oac (more details), 2 Å

PDB Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1oacb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oacb4 d.82.1.1 (B:5-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
dnkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1oacb4:

Click to download the PDB-style file with coordinates for d1oacb4.
(The format of our PDB-style files is described here.)

Timeline for d1oacb4: