Lineage for d1oacb4 (1oac B:5-90)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135259Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 135260Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 135261Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 135262Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 135263Species Escherichia coli [TaxId:562] [55386] (10 PDB entries)
  8. 135265Domain d1oacb4: 1oac B:5-90 [40004]
    Other proteins in same PDB: d1oaca1, d1oaca2, d1oaca3, d1oacb1, d1oacb2, d1oacb3

Details for d1oacb4

PDB Entry: 1oac (more details), 2 Å

PDB Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution

SCOP Domain Sequences for d1oacb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oacb4 d.82.1.1 (B:5-90) Copper amine oxidase, domain N {Escherichia coli}
ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
dnkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1oacb4:

Click to download the PDB-style file with coordinates for d1oacb4.
(The format of our PDB-style files is described here.)

Timeline for d1oacb4: