Lineage for d1oaca4 (1oac A:5-90)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606962Fold d.82: N domain of copper amine oxidase-like [55382] (3 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 606963Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 606964Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 606965Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 606966Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)
  8. 606967Domain d1oaca4: 1oac A:5-90 [40003]
    Other proteins in same PDB: d1oaca1, d1oaca2, d1oaca3, d1oacb1, d1oacb2, d1oacb3

Details for d1oaca4

PDB Entry: 1oac (more details), 2 Å

PDB Description: crystal structure of a quinoenzyme: copper amine oxidase of escherichia coli at 2 angstroems resolution

SCOP Domain Sequences for d1oaca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaca4 d.82.1.1 (A:5-90) Copper amine oxidase, domain N {Escherichia coli}
ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
dnkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1oaca4:

Click to download the PDB-style file with coordinates for d1oaca4.
(The format of our PDB-style files is described here.)

Timeline for d1oaca4: