Lineage for d6m5ob_ (6m5o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896255Protein Serine hydroxymethyltransferase [53429] (7 species)
  7. 2896310Species Human (Homo sapiens), mitochondrial [TaxId:9606] [142671] (9 PDB entries)
    Uniprot P34897 42-504
  8. 2896313Domain d6m5ob_: 6m5o B: [400001]
    automated match to d3ou5a_
    complexed with dxc, gly

Details for d6m5ob_

PDB Entry: 6m5o (more details), 2.3 Å

PDB Description: co-crystal structure of human serine hydroxymethyltransferase 2 in complex with pyridoxal 5'-phosphate (plp) and glycodeoxycholic acid
PDB Compounds: (B:) Serine hydroxymethyltransferase, mitochondrial

SCOPe Domain Sequences for d6m5ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m5ob_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
rgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggphnhaiaavavalkqa
ctpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlel
vsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskt
aklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh

SCOPe Domain Coordinates for d6m5ob_:

Click to download the PDB-style file with coordinates for d6m5ob_.
(The format of our PDB-style files is described here.)

Timeline for d6m5ob_: