Lineage for d1qkif2 (1qki F:200-434,F:450-511)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81766Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 81767Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 81768Species Human (Homo sapiens) [TaxId:9606] [55381] (1 PDB entry)
  8. 81774Domain d1qkif2: 1qki F:200-434,F:450-511 [40000]
    Other proteins in same PDB: d1qkia1, d1qkib1, d1qkic1, d1qkid1, d1qkie1, d1qkif1, d1qkig1, d1qkih1

Details for d1qkif2

PDB Entry: 1qki (more details), 3 Å

PDB Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+

SCOP Domain Sequences for d1qkif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkif2 d.81.1.5 (F:200-434,F:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens)}
dhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdv
mqnhllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeat
kgylddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagd
ifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpXmhfv
rsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfqyegtykwvn

SCOP Domain Coordinates for d1qkif2:

Click to download the PDB-style file with coordinates for d1qkif2.
(The format of our PDB-style files is described here.)

Timeline for d1qkif2: