Lineage for d1qkid2 (1qki D:200-434,D:450-511)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659519Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1659531Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 1659532Species Human (Homo sapiens) [TaxId:9606] [55381] (1 PDB entry)
  8. 1659536Domain d1qkid2: 1qki D:200-434,D:450-511 [39998]
    Other proteins in same PDB: d1qkia1, d1qkib1, d1qkic1, d1qkid1, d1qkie1, d1qkif1, d1qkig1, d1qkih1
    complexed with goa, gol, nap

Details for d1qkid2

PDB Entry: 1qki (more details), 3 Å

PDB Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+
PDB Compounds: (D:) glucose-6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1qkid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkid2 d.81.1.5 (D:200-434,D:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
dhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdv
mqnhllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeat
kgylddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagd
ifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpXmhfv
rsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfqyegtykwvn

SCOPe Domain Coordinates for d1qkid2:

Click to download the PDB-style file with coordinates for d1qkid2.
(The format of our PDB-style files is described here.)

Timeline for d1qkid2: