SCOPe 2.08: Domain d6ls4a2: 6ls4 A:248-436

Lineage for d6ls4a2 (6ls4 A:248-436)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d6ls4a2: 6ls4 A:248-436 [399958]
   Other proteins in same PDB: d6ls4a1, d6ls4b1, d6ls4c1, d6ls4d1, d6ls4e1, d6ls4e2
   automated match to d4i50a2
   complexed with gdp, gol, gtp, mes, mg, s40

Details for d6ls4a2

PDB Entry: 6ls4, 2.4 Å

PDB Description: a novel anti-tumor agent s-40 in complex with tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6ls4a2:

Sequence, based on SEQRES records:

>d6ls4a2 d.79.2.1 (A:248-436) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdp
rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
lekdyeevg

Sequence, based on observed residues (ATOM records):

>d6ls4a2 d.79.2.1 (A:248-436) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lnvdltefqtnlvpyprihfplatyapvisaeheqlsvaeitnacfepanqmvkcdprhg
kymaccllyrgdvvpkdvnaaiatiktrsiqfvdwcptgfkvginyqpptvvpggdlakv
qravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekd
yeevg

Timeline for d6ls4a2:

• d6ls4a2 first appeared in SCOPe 2.07