Lineage for d6ls4a1 (6ls4 A:2-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863851Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)
  8. 2863865Domain d6ls4a1: 6ls4 A:2-245 [399957]
    Other proteins in same PDB: d6ls4a2, d6ls4b2, d6ls4c2, d6ls4d2, d6ls4e1, d6ls4e2
    automated match to d5fnva1
    complexed with gdp, gol, gtp, mes, mg, s40

Details for d6ls4a1

PDB Entry: 6ls4 (more details), 2.4 Å

PDB Description: a novel anti-tumor agent s-40 in complex with tubulin
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6ls4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ls4a1 c.32.1.1 (A:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitas
lrfd

SCOPe Domain Coordinates for d6ls4a1:

Click to download the PDB-style file with coordinates for d6ls4a1.
(The format of our PDB-style files is described here.)

Timeline for d6ls4a1: