| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
| Domain d6ls4a1: 6ls4 A:2-245 [399957] Other proteins in same PDB: d6ls4a2, d6ls4b2, d6ls4c2, d6ls4d2, d6ls4e1, d6ls4e2 automated match to d5fnva1 complexed with gdp, gol, gtp, mes, mg, s40 |
PDB Entry: 6ls4 (more details), 2.4 Å
SCOPe Domain Sequences for d6ls4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ls4a1 c.32.1.1 (A:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitas
lrfd
Timeline for d6ls4a1: