Lineage for d2dpga2 (2dpg A:182-412,A:427-485)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1916230Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1916242Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 1916252Species Leuconostoc mesenteroides [TaxId:1245] [55380] (9 PDB entries)
  8. 1916257Domain d2dpga2: 2dpg A:182-412,A:427-485 [39991]
    Other proteins in same PDB: d2dpga1
    complexed with nap; mutant

Details for d2dpga2

PDB Entry: 2dpg (more details), 2.5 Å

PDB Description: complex of inactive mutant (h240->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with nadp+
PDB Compounds: (A:) glucose 6-phosphate dehydrogenase

SCOPe Domain Sequences for d2dpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpga2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]}
kemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnnt
mqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpyl
eeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgse
qeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpXgsnfadwn
gvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangdawvfkg

SCOPe Domain Coordinates for d2dpga2:

Click to download the PDB-style file with coordinates for d2dpga2.
(The format of our PDB-style files is described here.)

Timeline for d2dpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dpga1