Lineage for d2dpg_2 (2dpg 182-412,427-485)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81766Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 81767Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 81777Species Leuconostoc mesenteroides [TaxId:1245] [55380] (9 PDB entries)
  8. 81782Domain d2dpg_2: 2dpg 182-412,427-485 [39991]
    Other proteins in same PDB: d2dpg_1

Details for d2dpg_2

PDB Entry: 2dpg (more details), 2.5 Å

PDB Description: complex of inactive mutant (h240->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with nadp+

SCOP Domain Sequences for d2dpg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpg_2 d.81.1.5 (182-412,427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides}
kemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnnt
mqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpyl
eeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgse
qeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpXgsnfadwn
gvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangdawvfkg

SCOP Domain Coordinates for d2dpg_2:

Click to download the PDB-style file with coordinates for d2dpg_2.
(The format of our PDB-style files is described here.)

Timeline for d2dpg_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dpg_1