Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [399745] (2 PDB entries) |
Domain d6ls0b_: 6ls0 B: [399900] automated match to d1vlga_ complexed with fe; mutant |
PDB Entry: 6ls0 (more details), 1.87 Å
SCOPe Domain Sequences for d6ls0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ls0b_ a.25.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} mvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfye yiyerggrveleaiekppsnwagikdafeaalkheefvtqsiynilelaseekdhatvsf lkwfvdeqveeedqvreildllekaygqmsvifqldrylgqre
Timeline for d6ls0b_: