Lineage for d1dpgb2 (1dpg B:182-412,B:427-485)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962135Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2962147Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 2962157Species Leuconostoc mesenteroides [TaxId:1245] [55380] (9 PDB entries)
  8. 2962159Domain d1dpgb2: 1dpg B:182-412,B:427-485 [39990]
    Other proteins in same PDB: d1dpga1, d1dpgb1
    complexed with po4
    has additional insertions and/or extensions that are not grouped together

Details for d1dpgb2

PDB Entry: 1dpg (more details), 2 Å

PDB Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
PDB Compounds: (B:) glucose 6-phosphate dehydrogenase

SCOPe Domain Sequences for d1dpgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpgb2 d.81.1.5 (B:182-412,B:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]}
kemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnht
mqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpyl
eeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgse
qeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpXgsnfadwn
gvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangdawvfkg

SCOPe Domain Coordinates for d1dpgb2:

Click to download the PDB-style file with coordinates for d1dpgb2.
(The format of our PDB-style files is described here.)

Timeline for d1dpgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpgb1