Lineage for d7lvlf_ (7lvl F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444814Species Candidatus liberibacter [TaxId:556287] [399635] (2 PDB entries)
  8. 2444820Domain d7lvlf_: 7lvl F: [399895]
    automated match to d3s8ha_
    complexed with lys

Details for d7lvlf_

PDB Entry: 7lvl (more details), 2.01 Å

PDB Description: dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
PDB Compounds: (F:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d7lvlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lvlf_ c.1.10.0 (F:) automated matches {Candidatus liberibacter [TaxId: 556287]}
mfqrsipalitpftkdnlidedsfvdhiewqisegssglvpagttgesstlsyeehcrvv
elcvktaagrvpvmagagsnntkesielaqyaqntgadallvvvpyynkpnkkgllahfg
sianavslpiyiynnpsrtviemdvdtmaelvktysnivgvkdatgrielasgqriacgs
dfiqlsgddssalgfnvhggvgcisvtanvapricaefqkaisegdyrqaleyqdklfpl
hqalfiepsissvkyalsrlgrnvslvvrapmvsileketmfaidqaldhiglcag

SCOPe Domain Coordinates for d7lvlf_:

Click to download the PDB-style file with coordinates for d7lvlf_.
(The format of our PDB-style files is described here.)

Timeline for d7lvlf_: