Lineage for d1dpga2 (1dpg A:182-412,A:427-485)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33919Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 33920Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 33930Species Leuconostoc mesenteroides [TaxId:1245] [55380] (5 PDB entries)
  8. 33931Domain d1dpga2: 1dpg A:182-412,A:427-485 [39989]
    Other proteins in same PDB: d1dpga1, d1dpgb1

Details for d1dpga2

PDB Entry: 1dpg (more details), 2 Å

PDB Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides

SCOP Domain Sequences for d1dpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpga2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides}
kemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnht
mqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpyl
eeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgse
qeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpXgsnfadwn
gvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangdawvfkg

SCOP Domain Coordinates for d1dpga2:

Click to download the PDB-style file with coordinates for d1dpga2.
(The format of our PDB-style files is described here.)

Timeline for d1dpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dpga1