Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385979] (354 PDB entries) |
Domain d7lkva_: 7lkv A: [399872] automated match to d2gt7a_ complexed with edo, y4j, y64 has additional subdomain(s) that are not in the common domain |
PDB Entry: 7lkv (more details), 1.55 Å
SCOPe Domain Sequences for d7lkva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lkva_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} gfrkmafpsgkvegcmvqvtcgtttlnglwlddvvycprhvictsedmlnpnyedllirk snhnflvqagnvqlrvighsmqncvlklkvdtanpktpkykfvriqpgqtfsvlacyngs psgvyqcamrpnftikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegnf ygpfvdrqtaqaagtdttitvnvlawlyaavingdrwflnrftttlndfnlvamkynyep ltqdhvdilgplsaqtgiavldmcaslkellqngmngrtilgsalledeftpfdvvrqc
Timeline for d7lkva_: