Lineage for d1evjb2 (1evj B:161-322)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1916230Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1916263Protein Glucose-fructose oxidoreductase [55377] (1 species)
    very similar to the glucose 6-phosphate dehydrogenase domain
  7. 1916264Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)
  8. 1916296Domain d1evjb2: 1evj B:161-322 [39986]
    Other proteins in same PDB: d1evja1, d1evjb1, d1evjc1, d1evjd1
    complexed with nad

Details for d1evjb2

PDB Entry: 1evj (more details), 2.7 Å

PDB Description: crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
PDB Compounds: (B:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1evjb2:

Sequence, based on SEQRES records: (download)

>d1evjb2 d.81.1.5 (B:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Sequence, based on observed residues (ATOM records): (download)

>d1evjb2 d.81.1.5 (B:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpan

SCOPe Domain Coordinates for d1evjb2:

Click to download the PDB-style file with coordinates for d1evjb2.
(The format of our PDB-style files is described here.)

Timeline for d1evjb2: