SCOPe 2.08: Domain d6lsmc2: 6lsm C:246-440

Lineage for d6lsmc2 (6lsm C:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d6lsmc2: 6lsm C:246-440 [399858]
Other proteins in same PDB: d6lsma1, d6lsmb1, d6lsmc1, d6lsmd1, d6lsme_, d6lsmf1, d6lsmf2, d6lsmf3
automated match to d4i50a2
complexed with acp, ca, cl, erx, gdp, gtp, mes, mg

Details for d6lsmc2

PDB Entry: 6lsm (more details), 2.75 Å

PDB Description: tubulin polymerization inhibitors

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6lsmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lsmc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d6lsmc2:

Click to download the PDB-style file with coordinates for d6lsmc2.
(The format of our PDB-style files is described here.)

Timeline for d6lsmc2: