Lineage for d6lsmc1 (6lsm C:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863851Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)
  8. 2863935Domain d6lsmc1: 6lsm C:1-245 [399857]
    Other proteins in same PDB: d6lsma2, d6lsmb2, d6lsmc2, d6lsmd2, d6lsme_, d6lsmf1, d6lsmf2, d6lsmf3
    automated match to d5fnva1
    complexed with acp, ca, cl, erx, gdp, gtp, mes, mg

Details for d6lsmc1

PDB Entry: 6lsm (more details), 2.75 Å

PDB Description: tubulin polymerization inhibitors
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6lsmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lsmc1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d6lsmc1:

Click to download the PDB-style file with coordinates for d6lsmc1.
(The format of our PDB-style files is described here.)

Timeline for d6lsmc1: