Lineage for d6llfa1 (6llf A:2-142)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2392187Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2392188Protein automated matches [190701] (13 species)
    not a true protein
  7. 2392279Species Janthinobacterium sp. [TaxId:213804] [399621] (9 PDB entries)
  8. 2392284Domain d6llfa1: 6llf A:2-142 [399833]
    Other proteins in same PDB: d6llfa2, d6llfa3, d6llfb2, d6llfb3, d6llfc2, d6llfc3
    automated match to d2de6a1
    complexed with edo, fe2, fes, gol, peg, pge, wbp

Details for d6llfa1

PDB Entry: 6llf (more details), 1.93 Å

PDB Description: biphenyl-2,2',3-triol-soaked resting complex of oxy and fd in carbazole 1,9a-dioxygenase
PDB Compounds: (A:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d6llfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6llfa1 b.33.1.0 (A:2-142) automated matches {Janthinobacterium sp. [TaxId: 213804]}
anvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridgk
lyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqkl
ktypvqeakgcvfiylgdgdp

SCOPe Domain Coordinates for d6llfa1:

Click to download the PDB-style file with coordinates for d6llfa1.
(The format of our PDB-style files is described here.)

Timeline for d6llfa1: