![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() |
![]() | Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins) |
![]() | Protein Glucose-fructose oxidoreductase [55377] (1 species) |
![]() | Species Zymomonas mobilis [TaxId:542] [55378] (2 PDB entries) |
![]() | Domain d1ofge2: 1ofg E:161-322 [39983] Other proteins in same PDB: d1ofga1, d1ofgb1, d1ofgc1, d1ofgd1, d1ofge1, d1ofgf1 |
PDB Entry: 1ofg (more details), 2.7 Å
SCOP Domain Sequences for d1ofge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofge2 d.81.1.5 (E:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis} dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan
Timeline for d1ofge2: