SCOP 1.55: Domain d1ofge2: 1ofg E:161-322

Lineage for d1ofge2 (1ofg E:161-322)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [55378] (2 PDB entries)

8. Domain d1ofge2: 1ofg E:161-322 [39983]
   Other proteins in same PDB: d1ofga1, d1ofgb1, d1ofgc1, d1ofgd1, d1ofge1, d1ofgf1

Details for d1ofge2

PDB Entry: 1ofg, 2.7 Å

PDB Description: glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ofge2:

Sequence; same for both SEQRES and ATOM records:

>d1ofge2 d.81.1.5 (E:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1ofge2:

• d1ofge2 appears in SCOP 1.57
  
• d1ofge2 appears in the current release, SCOPe 2.08