SCOPe 2.08: Domain d6ls4c1: 6ls4 C:1-245

Lineage for d6ls4c1 (6ls4 C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d6ls4c1: 6ls4 C:1-245 [399816]
   Other proteins in same PDB: d6ls4a2, d6ls4b2, d6ls4c2, d6ls4d2, d6ls4e1, d6ls4e2
   automated match to d5fnva1
   complexed with gdp, gol, gtp, mes, mg, s40

Details for d6ls4c1

PDB Entry: 6ls4, 2.4 Å

PDB Description: a novel anti-tumor agent s-40 in complex with tubulin

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6ls4c1:

Sequence; same for both SEQRES and ATOM records:

>d6ls4c1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6ls4c1:

• d6ls4c1 first appeared in SCOPe 2.07