Lineage for d6lpsa_ (6lps A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831231Species Bacillus halodurans [TaxId:86665] [188453] (2 PDB entries)
  8. 2831232Domain d6lpsa_: 6lps A: [399815]
    automated match to d2f8qa_
    complexed with mg

Details for d6lpsa_

PDB Entry: 6lps (more details), 2.21 Å

PDB Description: crystal structure of family 10 xylanase from bacillus halodurans
PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d6lpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lpsa_ c.1.8.3 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
ndqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpr
egewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkank
qlllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetar
kyggeeaklyindyntenpskrddlynlvkdlleqgvpidgvghqshisigrpsiedtra
sfekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsa
tissvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriid

SCOPe Domain Coordinates for d6lpsa_:

Click to download the PDB-style file with coordinates for d6lpsa_.
(The format of our PDB-style files is described here.)

Timeline for d6lpsa_: