![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (28 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:86665] [188453] (2 PDB entries) |
![]() | Domain d6lpsa_: 6lps A: [399815] automated match to d2f8qa_ complexed with mg |
PDB Entry: 6lps (more details), 2.21 Å
SCOPe Domain Sequences for d6lpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lpsa_ c.1.8.3 (A:) automated matches {Bacillus halodurans [TaxId: 86665]} ndqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpr egewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkank qlllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetar kyggeeaklyindyntenpskrddlynlvkdlleqgvpidgvghqshisigrpsiedtra sfekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsa tissvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriid
Timeline for d6lpsa_: