Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
Domain d6ls4b2: 6ls4 B:244-429 [399814] Other proteins in same PDB: d6ls4a1, d6ls4b1, d6ls4c1, d6ls4d1, d6ls4e1, d6ls4e2 automated match to d3rycd2 complexed with gdp, gol, gtp, mes, mg, s40 |
PDB Entry: 6ls4 (more details), 2.4 Å
SCOPe Domain Sequences for d6ls4b2:
Sequence, based on SEQRES records: (download)
>d6ls4b2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdat
>d6ls4b2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsraltvpeltqqmfdsknmmaacdprhgr yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdat
Timeline for d6ls4b2: