Lineage for d1ofgc2 (1ofg C:161-322)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81766Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 81788Protein Glucose-fructose oxidoreductase [55377] (1 species)
  7. 81789Species Zymomonas mobilis [TaxId:542] [55378] (2 PDB entries)
  8. 81792Domain d1ofgc2: 1ofg C:161-322 [39981]
    Other proteins in same PDB: d1ofga1, d1ofgb1, d1ofgc1, d1ofgd1, d1ofge1, d1ofgf1

Details for d1ofgc2

PDB Entry: 1ofg (more details), 2.7 Å

PDB Description: glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ofgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofgc2 d.81.1.5 (C:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOP Domain Coordinates for d1ofgc2:

Click to download the PDB-style file with coordinates for d1ofgc2.
(The format of our PDB-style files is described here.)

Timeline for d1ofgc2: