SCOPe 2.08: Domain d6lsne_: 6lsn E:

Lineage for d6lsne_ (6lsn E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries)

8. Domain d6lsne_: 6lsn E: [399804]
   Other proteins in same PDB: d6lsna1, d6lsna2, d6lsnb1, d6lsnb2, d6lsnc1, d6lsnc2, d6lsnd1, d6lsnd2, d6lsnf1, d6lsnf2, d6lsnf3
   automated match to d4i55e_
   complexed with acp, ca, cl, err, gdp, gtp, mes, mg

Details for d6lsne_

PDB Entry: 6lsn, 2.45 Å

PDB Description: crystal structure of tubulin-inhibitor complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6lsne_:

Sequence, based on SEQRES records:

>d6lsne_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeeas

Sequence, based on observed residues (ATOM records):

>d6lsne_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eeas

Timeline for d6lsne_:

• d6lsne_ first appeared in SCOPe 2.07