SCOPe 2.08: Domain d6ls4e1: 6ls4 E:2-140

Lineage for d6ls4e1 (6ls4 E:2-140)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein automated matches [317456] (2 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [317457] (3 PDB entries)

8. Domain d6ls4e1: 6ls4 E:2-140 [399799]
   Other proteins in same PDB: d6ls4a1, d6ls4a2, d6ls4b1, d6ls4b2, d6ls4c1, d6ls4c2, d6ls4d1, d6ls4d2, d6ls4e2
   automated match to d4i55e_
   complexed with gdp, gol, gtp, mes, mg, s40

Details for d6ls4e1

PDB Entry: 6ls4, 2.4 Å

PDB Description: a novel anti-tumor agent s-40 in complex with tubulin

PDB Compounds: (E:) Stathmin

SCOPe Domain Sequences for d6ls4e1:

Sequence, based on SEQRES records:

>d6ls4e1 a.137.10.1 (E:2-140) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d6ls4e1 a.137.10.1 (E:2-140) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dmevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d6ls4e1:

• d6ls4e1 first appeared in SCOPe 2.07