SCOPe 2.01: Domain d1ofga2: 1ofg A:161-322

Lineage for d1ofga2 (1ofg A:161-322)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)

8. Domain d1ofga2: 1ofg A:161-322 [39979]
   Other proteins in same PDB: d1ofga1, d1ofgb1, d1ofgc1, d1ofgd1, d1ofge1, d1ofgf1
   complexed with ndp

Details for d1ofga2

PDB Entry: 1ofg, 2.7 Å

PDB Description: glucose-fructose oxidoreductase

PDB Compounds: (A:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1ofga2:

Sequence; same for both SEQRES and ATOM records:

>d1ofga2 d.81.1.5 (A:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1ofga2:

• d1ofga2 first appeared (with stable ids) in SCOP 1.55
  
• d1ofga2 appears in SCOP 1.75
  
• d1ofga2 appears in SCOPe 2.02
  
• d1ofga2 appears in the current release, SCOPe 2.08