Lineage for d6ls4d2 (6ls4 D:244-431)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566427Domain d6ls4d2: 6ls4 D:244-431 [399781]
    Other proteins in same PDB: d6ls4a1, d6ls4b1, d6ls4c1, d6ls4d1, d6ls4e1, d6ls4e2
    automated match to d3rycd2
    complexed with gdp, gol, gtp, mes, mg, s40

Details for d6ls4d2

PDB Entry: 6ls4 (more details), 2.4 Å

PDB Description: a novel anti-tumor agent s-40 in complex with tubulin
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d6ls4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ls4d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d6ls4d2:

Click to download the PDB-style file with coordinates for d6ls4d2.
(The format of our PDB-style files is described here.)

Timeline for d6ls4d2: