Lineage for d6ltqd_ (6ltq D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497212Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2497275Family c.56.4.0: automated matches [191433] (1 protein)
    not a true family
  6. 2497276Protein automated matches [190623] (6 species)
    not a true protein
  7. 2497287Species Fervidobacterium islandicum [TaxId:2423] [399722] (1 PDB entry)
  8. 2497291Domain d6ltqd_: 6ltq D: [399763]
    automated match to d1iofa_
    complexed with 1pe, gol, ocs

Details for d6ltqd_

PDB Entry: 6ltq (more details), 1.85 Å

PDB Description: crystal structure of pyrrolidone carboxyl peptidase from thermophilic keratin degrading bacterium fervidobacterium islandicum aw-1 (fipcp)
PDB Compounds: (D:) Pyroglutamyl-peptidase I

SCOPe Domain Sequences for d6ltqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ltqd_ c.56.4.0 (D:) automated matches {Fervidobacterium islandicum [TaxId: 2423]}
sglsdskklsvlltgfepfggekvnpsmrivkrlskavfphislhtlilpvsyqkstevl
eeyyktnnidialhlgqaggsagirlervainlldskhpdndgqvkedvsiidngpdaym
trvkikavaellkkkkipafvsytagqyicnevyyyslhrsnvtgtpkhalfvhlpflpe
qvatkegkleklpsmtlelqtkavrlilenlkefi

SCOPe Domain Coordinates for d6ltqd_:

Click to download the PDB-style file with coordinates for d6ltqd_.
(The format of our PDB-style files is described here.)

Timeline for d6ltqd_: