Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.0: automated matches [191433] (1 protein) not a true family |
Protein automated matches [190623] (6 species) not a true protein |
Species Fervidobacterium islandicum [TaxId:2423] [399722] (1 PDB entry) |
Domain d6ltqd_: 6ltq D: [399763] automated match to d1iofa_ complexed with 1pe, gol, ocs |
PDB Entry: 6ltq (more details), 1.85 Å
SCOPe Domain Sequences for d6ltqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ltqd_ c.56.4.0 (D:) automated matches {Fervidobacterium islandicum [TaxId: 2423]} sglsdskklsvlltgfepfggekvnpsmrivkrlskavfphislhtlilpvsyqkstevl eeyyktnnidialhlgqaggsagirlervainlldskhpdndgqvkedvsiidngpdaym trvkikavaellkkkkipafvsytagqyicnevyyyslhrsnvtgtpkhalfvhlpflpe qvatkegkleklpsmtlelqtkavrlilenlkefi
Timeline for d6ltqd_: