![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins) |
![]() | Protein Dihydrodipicolinate reductase [55371] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55372] (5 PDB entries) |
![]() | Domain d1arzb2: 1arz B:131-240 [39975] Other proteins in same PDB: d1arza1, d1arzb1, d1arzc1, d1arzd1 |
PDB Entry: 1arz (more details), 2.6 Å
SCOP Domain Sequences for d1arzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arzb2 d.81.1.3 (B:131-240) Dihydrodipicolinate reductase {Escherichia coli} vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
Timeline for d1arzb2: